Easy Saffron Creme Brulee Food

facebook share image   twitter share image   pinterest share image   E-Mail share image

BRULEED SAFFRON CUSTARDS



Bruleed Saffron Custards image

Martha transforms haleeb bil zaafaran, an Emirati milk-and-saffron drink typically served at breakfast, into creamy custards with crackly burnt sugar crusts.

Provided by Martha Stewart

Categories     Food & Cooking     Dessert & Treats Recipes

Yield Makes 6

Number Of Ingredients 7

2 1/2 cups whole milk
1/2 cup heavy cream
1/2 teaspoon saffron threads
5 cardamom pods, crushed
6 large egg yolks
1/3 cup sugar, plus 3 tablespoons for sprinkling
Pinch of kosher salt

Steps:

  • Preheat oven to 325 degrees. Bring a kettle or pot of water to a boil. Place six 1/2-cup baking dishes in a large baking or roasting pan.
  • In a medium saucepan, combine milk, cream, saffron, and cardamom. Heat over medium just until mixture begins to bubble around the edge of the pot, 7 to 8 minutes. Remove from heat and let steep at least 20 minutes.
  • Whisk together egg yolks with 1/3 cup sugar and salt in a large bowl. While whisking constantly, add a small ladle of hot milk mixture to the yolks. Repeat process until all of the milk mixture has been incorporated. Strain mixture through a fine sieve into a large liquid measuring cup.
  • Divide custard evenly among baking dishes. Place pan in oven and add enough boiling water to pan to reach halfway up the sides of the dishes. Cover baking pan with parchment-lined foil and bake until custards are just set (they should tremble slightly in center when shaken), 30 to 40 minutes.
  • Using tongs, carefully remove custards from hot water bath to a wire rack and let cool for 30 minutes. Refrigerate, covered with plastic wrap, at least 2 hours and up to 3 days.
  • Sprinkle each custard with 1/2 tablespoon sugar. Working with one at a time, hold a handheld kitchen 1 to 2 inches above surface and move flame in a circular motion until sugar bubbles, turns amber, and forms a smooth surface. Serve immediately.

THE BEST CREME BRULEE



The Best Creme Brulee image

We wanted a rich and creamy custard that wasn't too sweet, so we could fully enjoy the signature crunchy layer of caramelized sugar on top. By only using egg yolks, we achieved a soft and creamy texture. We tried using milk and half-and-half but, in the end, we landed with heavy cream for its richness. Whole vanilla beans give a more intense, pure vanilla flavor that you can't get from extract. We also like seeing the vanilla seeds flecked throughout the custard.

Provided by Food Network Kitchen

Categories     dessert

Time 45m

Yield 4 servings

Number Of Ingredients 5

2 1/2 cups heavy cream
1 vanilla bean, split lengthwise
1/4 teaspoon kosher salt
12 tablespoons sugar
7 large egg yolks

Steps:

  • Arrange a rack in the center of the oven and preheat to 300 degrees F. Line a large heavy roasting pan (a turkey roasting pan works great) with a clean kitchen towel and place 4 six-ounce ramekins on top of the towel spaced a few inches apart.
  • Heat the cream in a medium saucepan over medium heat. Using the back of a paring knife, scrape the vanilla seeds from both halves of the pod. Add the seeds and pod to the cream. Whisk in the salt and 3 tablespoons of the sugar and bring to a boil. Remove from the heat.
  • Vigorously whisk the yolks and 3 more tablespoons of the sugar in a large bowl until pale yellow and very thick and creamy, about 2 minutes. Alternatively, you can use an electric mixer on high speed and beat until pale yellow and very thick and creamy, about 1 minute.
  • Whisking the yolks constantly, add a couple of teaspoons at a time from 1 cup of the hot cream, then increase to a steady stream until the cream is fully incorporated. (Don't pour too much hot cream at once or you'll end up with scrambled eggs.) The yolks are now tempered. Whisk the tempered yolks back into the remaining hot cream until combined. Strain through a fine mesh sieve into a large measuring cup or medium pitcher for easier pouring; discard the vanilla pods.
  • Skim the foam off the top of the custard by placing a clean paper towel on top and lightly pressing down so it touches the surface and absorbs some of the liquid. This will make for a completely smooth and silky custard. Fill the ramekins with the custard, about 3/4 cup per ramekin.
  • Carefully pour boiling water into the roasting pan halfway up the sides of the ramekins without getting any water in the custard. Cover the pan tightly with foil and bake until the custard is set around the edges but still has a slight jiggle in the center, 35 to 45 minutes. Carefully remove the roasting pan from the oven and transfer the ramekins to a wire rack to cool for 30 minutes. Then refrigerate until very cold, about 3 hours.
  • Just before serving, evenly spread 1 tablespoon of the sugar over the top of a custard. Hold a kitchen torch 2 inches above the surface. Starting in the center of the ramekin, move the flame in a circular motion and work your way out to the edges to caramelize the sugar. Repeat with the remaining sugar and custards.
  • Alternatively, arrange a rack in the top position of the oven and heat the broiler on high. Place the ramekins on a rack set inside a baking sheet and broil until deep golden brown, 15 to 60 seconds, checking every 10 seconds.
  • Freeze the custards for 5 minutes before serving (see Cook's Note).

SAFFRON CARDAMOM CREME BRULéE



Saffron Cardamom Creme Brulée image

An exotic twist on a classic French recipe. The delicate fragrant saffron is what makes this dessert truly special.

Provided by DoctorDave

Categories     Dessert

Time 2h

Yield 6-8 serving(s)

Number Of Ingredients 6

1/3 g saffron
5 whole cardamom pods
2 teaspoons rose water
2 cups heavy cream
4 egg yolks
1/4 cup sugar

Steps:

  • Bang cardamom pods lightly in a mortar and pestle. Add cream, saffron strands and cardamom to a small saucepan. Scald the cream (heat it on moderately high heat until little bubbles are forming around the edge) - watch it like a hawk - you don't want it boiling and you don't want to waste your precious saffron. Take it off the fire. Cover the saucepan and leave it sit for 30 minutes. Scald it again and take off the fire the let it sit for another 30 minutes (you want the saffron steeping for a long time to extract as much of the flavor as possible).
  • Pass the cream mixture though a fine sieve and discard the solids. If it's cooled down scald it once more.
  • Combine egg yolks, sugar and rose water in a deep bowl. Whisk it with a fork to a paste. Temper in the cream mixture (slowly add the warm cream in while stirring so the egg mixture does not heat up too fast and start to cook).
  • Pour the liquid into 3 or 4 ounce creme brulée ramekins and set up a bain marie - that is a water bath - you do this by placing the ramekins in a roasting or baking pan and add water to the pan so that it reaches almost as high as your custard level. Be careful not to let water get into the ramekins.
  • Bake in the oven at 325 for about 30 minutes. It is done when it jiggles only slightly in the middle when the ramekin is tapped from the side. I recommend checking on it at 20 minutes and every 5 minutes thereafter. It's hard to predict how long it will take. Remove from the oven and from the bain marie. Let cool on the countertop and once cooled down refrigerate.
  • 5 minutes prior to serving take out of the fridge and dust the tops with sugar in the raw then get out your butane torch and burn the sugar going slowly from spot to spot.

SIMPLE CREME BRULEE DESSERT



Simple Creme Brulee Dessert image

Rich, creamy creme brulee should still be jiggly in the center when you pull it out of the oven.

Provided by sous-chef-jason

Categories     World Cuisine Recipes     European     French

Time 3h15m

Yield 2

Number Of Ingredients 5

3 tablespoons white sugar
1 cup heavy cream
3 egg yolks
¼ teaspoon vanilla extract
2 tablespoons white sugar, divided

Steps:

  • Preheat oven to 350 degrees F (175 degrees C).
  • Whisk 3 tablespoons sugar and cream in a microwave-safe bowl until well combined; heat the mixture in microwave until warm, 1 to 2 minutes, and whisk again to dissolve sugar. Whisk in egg yolks and vanilla extract until smooth.
  • Pour cream mixture into 2 ramekins. Set ramekins into a roasting pan and pour in enough hot water to reach halfway up the sides of the ramekins.
  • Bake in the preheated oven until creme desserts are set but still slightly jiggly when shaken, about 50 minutes. Remove ramekins from hot water and chill in refrigerator until cold, at least 2 hours.
  • Sprinkle 1 tablespoon of sugar evenly over the top of each dessert. Use a kitchen torch to lightly toast and melt the sugar topping until brown and bubbly, about 30 seconds. Let the sugar topping cool before serving. To serve, use a spoon to crack the crisp sugar open to reveal the creamy dessert underneath.

Nutrition Facts : Calories 612 calories, Carbohydrate 35.5 g, Cholesterol 470.3 mg, Fat 50.6 g, Protein 6.4 g, SaturatedFat 29.8 g, Sodium 57.2 mg, Sugar 31.6 g

SIMPLE CREME BRULEE



Simple Creme Brulee image

Provided by Food Network Kitchen

Categories     dessert

Yield 6

Number Of Ingredients 5

4 cups heavy cream
1 teaspoon vanilla extract
1/2 cup sugar
6 egg yolks
1/2 cup dark brown sugar

Steps:

  • Preheat oven to 300 degrees. In a medium sauce pan, heat the cream and vanilla to a simmer. Remove pan from heat and let sit for 10 minutes. In a bowl whisk together the sugar and yolks until they are a pale yellow. Whisk cream into the egg mixture and pour into 6 flameproof custard dishes.
  • Place dishes in a large flameproof baking dish lined with a towel. Pour boiling water into baking dish so that it comes to half way up the custard dishes. Bake for 30 minutes or until custard is firm but still wiggles. Chill for at least one hour. Top with brown sugar in an even layer and place under broiler until sugar melts and bubbles. Serve at room temperature.

More about "easy saffron creme brulee food"

SAFFRON CRèME BRûLéE TART RECIPE | DELICIOUS. MAGAZINE
saffron-crme-brle-tart-recipe-delicious-magazine image
Web Apr 12, 2016 The custard creaminess of Debbie Major’s crème brûlée tart is a perfect match for the fragrant addition of saffron. Nutrition: per …
From deliciousmagazine.co.uk
5/5 (2)
Category Low-Fat Desserts
Cuisine French Recipes
Calories 544 per serving
  • For the pastry, sift the flour, salt and icing sugar into a food processor. Add the butter and process briefly until the mixture looks like fine breadcrumbs. Beat the egg yolk briefly with 4 tsp water. Tip the crumbed mixture into a bowl and stir in the egg yolk/water mixture to bring the dough together into a ball (add the extra tsp cold water if it’s too dry). Turn out onto a lightly floured surface and knead briefly until smooth. Chill for 15 minutes, then remove from the fridge and roll out thinly on a lightly floured surface. Use the pastry to line the tart tin, then rest the pastry case in the fridge for 20 minutes.
  • Put a baking sheet onto the middle rack of the oven and heat it to 200°C/180°C fan/gas 6. Line the pastry case with foil, fill with baking beans/uncooked rice, then bake, on the hot baking sheet, for 15-20 minutes until the edges are biscuit-coloured. Remove the foil and beans/rice, protect the edge of the case with thin strips of foil, then return it to the oven for another 5 minutes or until the base is crisp and biscuit brown. Remove and leave to cool (leave the baking sheet in the oven). Turn the oven down to 140°C/120°C fan/gas 2.
  • For the filling, heat a small, clean frying pan over a medium-high heat. Add the saffron strands and toss them around for just a few seconds until they look very slightly darker. Tip them into a mortar, leave to cool and become brittle, then grind the strands into a fine powder with the pestle. Heat the milk in a small pan to almost boiling point, then pour it onto the saffron powder and stir well. Leave to cool.
  • Pour the double cream into a clean pan and bring almost to the boil. Meanwhile, stir the egg yolks and 50g sugar in a bowl until just combined. Pour the hot cream onto the egg yolks, stirring gently with a whisk, then gently stir in the saffron milk (you don’t want to whisk a lot of air into the custard). Strain through a fine sieve into a large jug, then scrape off and discard any froth from the top with a spoon.


EASY CRèME BRûLéE - LIVE WELL BAKE OFTEN
easy-crme-brle-live-well-bake-often image
Web Feb 5, 2019 To make this easy crème brûlée, start by setting a pot of water to boil while you’re preparing the mixture. The water will be used for a water bath to cook them in, which I’ll explain a little later on. Then, whisk …
From livewellbakeoften.com


EASY SAFFRON & ROSE WATER FLAVOURED CRèME BRûLéE – …
easy-saffron-rose-water-flavoured-crme-brle image
Web Feb 13, 2021 Easy & quick family recipe for Saffron & Rose Water Crème Brûlée South Asian or Indian style with creamy melt-in-your-mouth taste and divine crunchy edges
From talkingoffood.ca


EASY CREME BRULEE RECIPE {A CLASSIC FRENCH DESSERT}
easy-creme-brulee-recipe-a-classic-french-dessert image
Web Nov 27, 2017 Creme Brulee is the perfect make-ahead dessert that will impress your guests! A silky, smooth vanilla custard topped with a layer of brittle caramel, that is easier to make at home than you think. This …
From platedcravings.com


CRèME BRûLéE | RICARDO
crme-brle-ricardo image
Web In a bowl, whisk together the egg yolks and half (1/4 cup/55 g) of the sugar. Whisk in the hot cream. Pour the mixture into the ramekins. Pour hot water into the baking dish ¾ up the sides of the ramekins.
From ricardocuisine.com


SAFFRON CREME BRULEE (SAFFRON BRULEE) RECIPE
saffron-creme-brulee-saffron-brulee image
Web DIRECTIONS: 1- Transfer heavy whipping cream to a saucepan. 2- Stir in saffron. 3- Over low heat, bring the heavy whipping cream just to a boil but don't allow to boil (about 120º F / 49º C). 4- Whisk egg yolks. 5- Stir in 3 …
From aashpazi.com


VALENTINE'S DAY - SAFFRON CREME BRULEE RECIPE ON FOOD52
valentines-day-saffron-creme-brulee-recipe-on-food52 image
Web Feb 11, 2019 In a small mixing bowl, add egg yolks, sugar, and salt. Whisk to combine. Set aside. In a saucepan over low heat, heat heavy cream, saffron, and green cardamom until the mixture heats to 160 F. Slowly …
From food52.com


SAFFRON CARDAMOM CREME BRULéE RECIPE - ARCHANA'S …
saffron-cardamom-creme-brule-recipe-archanas image
Web May 29, 2016 2913 ratings. Saffron Cardamom Creme Brulée is a french classic dish that serves as a dessert. Saffron Cardamom Creme Brulée is loaded with warm mushy flavors of saffron and with the taste of …
From archanaskitchen.com


EASY CREME BRULEE RECIPE (VIDEO)
easy-creme-brulee-recipe-video image
Web Feb 10, 2023 Crème Brûlée (pronounced “krem-broo-lay”) means “burnt cream” in French. It’s a classic dessert made from a creamy custard base topped with a layer of sugar. The sugar is then caramelized or “burnt” …
From natashaskitchen.com


EASY CRèME BRûLéE RECIPE (6 INGREDIENTS) - SALLY'S …
easy-crme-brle-recipe-6-ingredients-sallys image
Web Jul 26, 2018 Cook: Heat the heavy cream + salt on the stove. Off heat, add vanilla to flavor. Whisk the egg yolks and sugar together. Temper the egg yolk mixture by slowly whisking in some of the warm heavy cream. …
From sallysbakingaddiction.com


RECIPES | CYRUS TODIWALA'S SAFFRON AND CARDAMOM CRèME …
Web Aug 28, 2014 Pour the milk into a heavy bottomed saucepan along with the ginger and cardamom pods and bring slowly to the boil. Reduce the heat and simmer gently …
From matchingfoodandwine.com


GOLDEN CORN CRÈME BRÛLÉE - PRESSREADER
Web Jun 28, 2023 Food & Drink. GOLDEN CORN CRÈME BRÛLÉE ... In a wide pot, combine corn cobs (broken in half), cream, milk, saffron and turmeric. Bring just to a boil over …
From pressreader.com


EASY SAFFRON CREME BRULEE RECIPE | MY SWISS KITCHEN
Web Feb 14, 2018 Learn about saffrons origins and history, and an easy recipe for Saffron Creme Brulee that will treat your tastebuds and keep you coming back for more!
From myswisskitchen.swisshikingvacations.com


HOW TO MAKE EASY CREME BRULEE RECIPE | THE RECIPE CRITIC
Web Dec 14, 2021 Granulated sugar: This makes the flavor sweet! Use a little bit less than called for on the recipe card if you don’t like it quite as sweet! You will also use this for …
From therecipecritic.com


CRèME BRûLéE (FRENCH VANILLA CUSTARD) | RECIPETIN EATS
Web Apr 23, 2021 This is French chic personified in a dessert – classy but not stuffy, and oh-so-effortless! It takes just 4 simple ingredients: cream, egg yolks, sugar and vanilla. It’s an …
From recipetineats.com


EASY SAFFRON CREME BRULEE | PUNCHFORK
Web 1 pinch saffron (about 12 threads) 6 teaspoons sugar; 2 cups half-and-half; One 3.4-ounce package instant vanilla pudding
From punchfork.com


EASY SAFFRON CREME BRULEE RECIPE | AYESHA CURRY | FOOD NETWORK
Web Sausage and Peppers Sheet Pan Dinner. Trending Recipes. Roasted Baby Potatoes with Rosemary
From foodnetwork.cel29.sni.foodnetwork.com


Are you curently on diet or you just want to control your food's nutritions, ingredients? We will help you find recipes by cooking method, nutrition, ingredients...
Check it out »

Related Search